Ilustrados comunidad mundial educativa
Inicio | Escribenos
User: Pass: Recordar ó (Registrate!)

| !Publicar Articulo¡

Biotecnología

Resumen: Algunos datos históricos. Concepto actual de Biotecnología. Ventajas e inconvenientes de la Biotecnología. El funcionamiento molecular de los seres vivos. Compendio de aplicaciones biotecnológicas. Cuestiones socioculturales y éticas planteadas por la Biotecnología. Glosario.(V)
2,397 visitas
Rating: 0
Tell a Friend
Autor: Bistec. Emilio Alfredo Lucas Carrillo
  1. Introducción
  2. Algunos datos históricos
  3. Concepto actual de Biotecnología
  4. Ventajas e inconvenientes de la Biotecnología
  5. El funcionamiento molecular de los seres vivos
  6. Compendio de aplicaciones biotecnológicas
  7. Cuestiones socioculturales y éticas planteadas por la Biotecnología
  8. Glosario
  9. Referencias

 

I. Introducción

Con este nombre entendemos la aplicación de los procesos propios de los seres vivos al sistema productivo, considerado éste en su sentido más amplio (producción industrial, salud, medio ambiente, etc.). Y la primera pregunta que nos planteamos es la siguiente: ¿Por qué los seres vivos? Trataremos de contestarla con algunos ejemplos.

(a) El músculo como máquina mecánica

El anuncio que aparece en la figura 1 fue comunicado a un congreso de ingenieros eléctricos en Estados Unidos. En él se habla de un motor lineal, de muy bajo costo, con unas características altamente deseables en todos los sentidos (tanto puramente mecánicas como de control) y que no es otro que el músculo. Lo cierto es que no hay una máquina artificial que presente las mismas prestaciones. Para ello no tenemos más que imaginar el corazón, como bomba muscular aspìrante-impelente, que funciona ininterrumpidamente durante todo el tiempo de la vida humana. O bien, el sistema neuromuscular que nos hace seguir con la vista la trayectoria de cualquier objeto móvil (el seguimiento de trayectorias de móviles es un problema de cálculo y hardware importantísimo en la tecnología militar, para el seguimiento de misiles)

(b) El proceso Haber

La industria química alemana, desarrollada sobre todo a finales del siglo XIX, ha carecido siempre de materias primas, como por ejemplo las necesarias para la fabricación de amoníaco, NH3, que a su vez es punto de partida de otros procesos muy importantes en la industria química. El químico alemán Fritz Haber ideó un proceso mediante el cual se hace reaccionar nitrógeno con hidrógeno en fase gaseosa, en presencia de catalizadores, a elevadas presiones y temperaturas (y por tanto, gran consumo de energía), que revolucionó en su día la industria química.

Pues bien: existen unas bacterias, las bacterias fijadoras de nitrógeno, que resuelven este mismo problema a la presión atmosférica y a la temperatura ambiente, gracias a la presencia en los seres vivos de enzimas, que son catalizadores extraordinariamente eficientes. Si conseguimos utilizar estas enzimas de la fijación de nitrógeno en un sentido biotecnológico, podremos tener un considerable ahorro energético.

(c) La producción de hormona de crecimiento y de insulina.

La hormona de crecimiento (STH) es una hormona necesaria para el crecimiento normal de la especie humana. Su falta determina la aparición de enanismos. En las personas en las que falta, se puede llegar a tener una talla normal si el individuo es tratado con STH desde los primeros años de su vida. La STH es una proteína. Las proteínas son macromoléculas cuya síntesis en el laboratorio, aunque posible, es enteramente prohibitiva en términos económicos. Sin embargo, las proteínas son sintetizadas por todos los seres vivos con toda facilidad.

Hasta hace pocos años, la STH se obtenía a partir de reses de matadero o bien, en algunos casos, de cadáveres humanos (con grandes inconvenientes; por ejemplo, la transmisión inintencionada de enfermedad de Kreutfeld-Jacob). La hormona se encuentra en una pequeña glándula situada en la base del cerebro (la hipófisis) y se necesitan muchas hipófisis para obtener una cantidad apreciable de STH.

La biotecnología nos ha permitido que en la actualidad, la STH se produzca por el siguiente procedimiento:

1. Se aísla el gen de la STH humana a partir de cualquier célula, no necesariamente la hipófisis.

2. Este gen se amplifica (es decir, se producen millones y millones de copias del mismo por diversos procedimientos)

3. Estas copias del gen se introducen en una bacteria de crecimiento muy rápido (la masa bacteriana de un cultivo puede llegar a duplicarse cada 15-20 minutos)

4. Las bacterias así modificadas genéticamente producen STH en grandes cantidades y a muy bajo costo (la producción de STH ni beneficia ni perjudica a la bacteria)

5. La STH se purifica a partir del cultivo bacteriano y está lista para su uso.

De manera esencialmente idéntica hoy día se producen muchas hormonas de carácter proteico indispensables en la Medicina; por ejemplo, insulina y calcitonina.

Estos tres ejemplos nos muestran que los seres vivos son capaces de llevar a cabo procesos químicos de síntesis con una eficiencia mucho mayor que la industria convencional desarrollada por el hombre. ¿Por qué? ¿Qué tienen de extraordinario los seres vivos?

La vida apareció en la Tierra hace unos 3500 millones de años. A partir de aquellas células primitivas, la vida ha ido evolucionando por selección natural hasta lo que conocemos hoy. Por lo tanto, todos los procesos químicos de los seres vivos han sido "ensayados" y "mejorados" a lo largo de este enorme período de tiempo. Por ello son procesos de gran eficacia y muy bajo costo energético y material. De ahí que hoy día sean objeto de muchísima y muy sofisticada investigación.

Estas capacidades tan peculiares de los seres vivos se deben a sus mecanismos moleculares de reconocimiento, en los que entraremos más adelante.

II. Algunos datos históricos

En sentido estricto, la Biotecnología tal como fue definida más arriba comenzó con la Revolución Neolítica, es decir, cuando la humanidad comenzó a hacer uso de la Agricultura y de la Ganadería para sus necesidades; un poco más tarde (pero no mucho más; recuérdese que la Biblia atribuye a Noé la invención del vino), el hombre comenzó a utilizar las fermentaciones para la producción de vino, cerveza, pan, queso, yogur, etc. Estas prácticas fueron mejorando sensiblemente a lo largo de la historia; pero comienzan a ser estudiadas científicamente con la Revolución Industrial.

El estudio de la fermentación alcohólica (producción de vino y cerveza) nos llevó a la comprensión detallada del proceso bioquímico de transformación de azúcares en alcohol. Con ello, y con los estudios microbiológicos correspondientes, las fermentaciones pudieron comenzar a hacerse a escala industrial (y no artesanal como hasta entonces). Por otra parte, el estudio de la fermentación alcohólica permitió la caracterización y purificación detallada de las enzimas que llevan a cabo el proceso, dando origen así a la Bioquímica moderna.

En los años veinte se descubren los antibióticos, sustancias producidas por determinados microorganismos para combatir a otros microorganismos (en concreto, la penilina es una sustancia producida por el hongo Penicillium notatum para destruir a las bacterias que puedan competir con él en la búsqueda de alimentos). Con la Segunda Guerra Mundial, se plantea el problema de la producción industrial de antibióticos. Esto se logra mediante procedimientos de fermentación análogos a la producción de cerveza. Hacia los años cincuenta y sesenta del siglo XX, pues, las fermentaciones son un proceso muy conocido, estudiado y aplicado, y que por las razones que veremos más adelante, pueden ya considerarse como biotecnología propiamente dicha.

Al mismo tiempo, se empiezan a reconocer las múltiples aplicaciones que pueden darse a las enzimas aisladas en procesos industriales. Hacia mediados de los sesenta, ya se emplean de forma generalizada enzimas obtenidos de seres vivos como aditivos de los detergentes de lavado doméstico. Hoy día, como veremos, las enzimas se emplean en muchísimos más procesos industriales.

Volvamos un poco atrás para analizar otra línea de investigación que ha llevado a la moderna biotecnología.

A partir de finales del XIX se empezaron a estudiar los mecanismos de la herencia biológica. Los trabajos de Mendel llevaron a la conclusión de que las características hereditarias se transmiten a través de elementos discretos, llamados genes, que pasan de una generación a otra. Nació así la ciencia de la Genética, uno de cuyos problemas fundamentales consistía en determinar la naturaleza físicoquímica de los genes. En 1944 se demostró que los genes están formados por ácido desoxirribonucleico (DNA, ADN), una macromolécula lineal. En 1953 Watson y Crick postularon un modelo de estructura que explicaba de forma totalmente satisfactoria cómo esta molécula puede ser efectivamente la portadora de los caracteres hereditarios en los seres vivos. En la década de los sesenta se demostró la naturaleza de la información que porta dicha molécula al ser descifrado el Código Genético.

En la década de los setenta, se idearon métodos para manipular el DNA y transferirlo de unos organismos a otros a voluntad, es decir, la transferencia genética no sólo entre individuos de la misma especie, sino de especies completamente distintas. El conjunto de esas técnicas es lo que ha venido en llamarse Ingeniería Genética, que forma hoy día una parte esencial de la Biotecnología. Mediante sus técnicas podemos introducir a voluntad (dentro de ciertos límites) genes determinados en organismos receptores, con lo cual las posibilidades de manipulación artificial de los seres vivos se multiplican. Es así como se puede introducir el gen de la hormona de crecimiento (STH) en una bacteria, la cual se reproduce exponencialmente al tiempo que produce dicha hormona, por ejemplo; o cómo podemos llegar a reemplazar un gen defectuoso en un individuo por un gen sano; o cómo podemos dotar a un organismo de unas capacidades bioquímicas que previamente no tenía (por ejemplo, la introducción en vegetales de los genes de fijación de nitrógeno bacterianos, de manera que no vuelven a requerir abonos nitrogenados en absoluto).

La biotecnología moderna se asienta así sobre dos pilares básicos: la tecnología enzimática y la ingeniería genética. A esto podemos añadir otras técnicas, que aunque relacionadas con estas dos, forman hoy día cuerpos aparte. Por ejemplo, las técnicas de reproducción asistida (manejo de células germinales y de embriones) y clonación animal; las técnicas inmunológicas, etc.

III. Concepto actual de Biotecnología

En sentido amplio, la Biotecnología es el aprovechamiento con fines económicos de los procesos físico-químicos desarrollados por los seres vivos. Mejor sería que para este sentido amplio utilizáramos el término Biotecnia, ya que Biotecnología es algo más restringido, como veremos más adelante. Dependiendo de los sistemas, la Biotecnia puede desarrollarse sobre:

(a) Organismos pluricelulares completos, o poblaciones de ellos.

Son la Agricultura (Fitotecnia) y la Ganadería (Zootecnia) en su sentido tradicional, aunque puedan verse ayudadas por técnicas estrictamente biotecnológicas, como veremos.

(b) Organismos unicelulares en cultivo

Con ellos llevamos a cabo los procesos de fermentación. Estos procesos pueden ser artesanales (la producción artesanal de vino, cerveza, pan, queso, yogur) o bien industriales (los antes mencionados, pero a escala industrial, más muchos otros procesos fermentativos de interés: producción de antibióticos, producción de compuestos químicos, producción de energía a partir de biomasa, etc.). Al igual que en el caso anterior, las producciones artesanales pueden ayudarse de técnicas biotecnológicas.

(c) Células individuales aisladas

Mediante operaciones sobre células individuales aisladas se llevan a cabo hoy día multitud de manipulaciones interesantes, por ejemplo:

- Técnicas de reproducción asistida: fecundación in vitro (niños probeta), clonación de individuos, etc.

- Producción de organismos transgénicos

- Producción de anticuerpos monoclonales

- Procesos industriales mediante células inmovilizadas

(d) Componentes celulares aislados

Estas técnicas se llevan a cabo sobre componentes químicos aislados de los seres vivos. Dependiendo del tipo de componentes, se hacen sobre Ácidos Nucleicos (Ingeniería Genética) o sobre Proteínas (Tecnología enzimática y otras).

Como es lógico, las manipulaciones pueden ser mixtas: hay procesos que implican individuos completos, células aisladas y componentes celulares a la vez, por ejemplo.

En sentido estricto, podemos considerar como Biotecnología la totalidad de (d) y (e) y las fermentaciones industriales citadas en (b). Esto no obsta para que el resto de las actividades biotécnicas puedan beneficiarse de la Biotecnología, como hemos visto.

IV. Ventajas e inconvenientes de la Biotecnología

Como todo avance tecnológico radical, la Biotecnología tiene sus ventajas y sus inconvenientes. De forma somera podemos sistematizarlos así:

(a) Ventajas

1. Bajo consumo energético

2. Facilidad de acceso a materias primas (producción in situ de las mismas)

3. Procesos contrastados y probados por una experiencia enormemente extensa (la totalidad de la evolución biológica)

4. Especificidad; entenderemos mejor esta característica más adelante.

5. Sustentabilidad medioambiental, por las razones 1 y 2.

(b) Inconvenientes

1. Requerimiento de muy alta tecnología, que se manifiesta en un personal de altísima cualificación profesional e inversiones generalmente muy fuertes y de alto riesgo.

2. Consecuencias biológicas y medioambientales aún no predecibles. En este sentido, la película "Parque Jurásico" de Spielberg según guión (e idea) de Michael Crichton pone el dedo en la llaga sobre las consecuencias impredecibles que puede llegar a tener la manipulación genética generalizada. No obstante, por la experiencia que ya se va reuniendo, estas posibilidades parece que son cada vez más remotas.

Aunque estos problemas serán tratados más adelante con cierto detenimiento, el punto de vista que parece prevalecer en la actualidad es que todo avance tecnológico tiene sus inconvenientes (si no conociéramos la electricidad no habría muertes por electrocución, por ejemplo); y que lo realmente importante a desarrollar es un control fuertemente democrático de las actividades biotecnológicas "sensibles", como las que atañen a la reproducción humana, o a los desarrollos de guerra biológica, etc.

V. El funcionamiento molecular de los seres vivos

Es absolutamente necesario tener una idea general sobre el funcionamiento de los seres vivos antes de seguir con esta exposición.

(a) La célula

La estructura organizativa fundamental de todos los seres vivos es la célula. La célula es un ente biológico autónomo, que eventualmente se reproduce y/o muere, y que desarrolla en su interior todos o la gran mayoría de los procesos físico-químicos característicos del ser vivo. Las células son de pequeño tamaño, y su individualidad está determinada por la existencia de una membrana que la separa del medio en que vive. Los organismos pueden ser unicelulares, cuando constan de una sola célula, o pluricelulares, cuando están formados por muchas células. En este último caso, el principio de división del trabajo se aplica a las diferentes células que constituyen este organismo, de manera que unas células determinadas ejecutan funciones que no llevan a cabo otras, y viceversa. Esta especialización recibe el nombre concreto de diferenciación celular.

Existen tres tipos básicos de células según su organización: eucariotes, bacterias y arquebacterias; estas dos últimas reciben el nombre genérico de procariotes. Las distinciones fundamentales son las siguientes:

1. Los eucariotes tienen un núcleo celular en el que está contenido el material genético. Los procariotes no tienen dicho núcleo, y el material genético está disperso en el citoplasma.

2. Los eucariotes contienen partículas subcelulares u organelas (mitocondrias, peroxisomas, lisosomas, etc.) dentro de sus células; los procariotes no.

3. Los eucariotes son células mucho más grandes que los procariotes, y su división celular es mucho más lenta que en éstos. Las velocidades de reproducción de los procariotes son enormes. Una bacteria puede fácilmente dividirse cada 15 minutos. Las mayores velocidades observadas en eucariotes se miden, por el contrario, en horas.

4. La totalidad de organismos pluricelulares (animales, plantas y hongos), así como todos los Protistas (protozoos) son eucariotes.

5. Las primeras formas de vida que surgieron en la evolución biológica fueron procariotes (hace 3500 millones de años). Los eucariotes aparecieron mucho más tarde, hace aproximadamente 1000 millones de años (Plantas). La gran diversidad de los eucariotes se ha conseguido gracias a que en éstos está generalizada la reproducción sexual, lo que acelera en gran medida el ritmo evolutivo de las especies.

La distinción entre bacterias y arquebacterias, dentro de los procariotes, se basa en una serie de criterios bioquímicos cuya enumeración se saldría del presente contexto. Sí que nos interesa saber, sin embargo, que las arquebacterias, muy a menudo, habitan en condiciones extremas de pH, temperatura, concentración salina, etc. (extremófilos), lo que las hace particularmente adecuadas para muchas aplicaciones biotecnológicas. Así, la flora microbiana de las fuentes termales (alta temperatura y bajo pH) suele estar constituída por arquebacterias. Igualmente hay multitud de arquebacterias en los fondos oceánicos, al lado de fuentes termales volcánicas, en condiciones extremas de temperatura y salinidad.

(b) La evolución por selección natural

Los seres vivos necesitan alimentarse. Al ser los recursos limitados, compiten unos con otros por el alimento o por la posibilidad de reproducción. De esta manera, sólo pueden llegar a reproducirse los más aptos, es decir, aquellos cuyas características están mejor adaptadas al medio ambiente. De esta manera, las características genéticas de los más aptos se transmiten a la descendencia y las de los menos adaptados no. De esta forma se van seleccionando de manera natural y espontánea aquellos caracteres que posibilitan o facilitan la reproducción de la especie, desapareciendo por el contrario aquellos otros que la dificultan o impiden. Así, las características morfológicas y funcionales (lo que llamamos en su conjunto el fenotipo) de los seres vivos van variando poco a poco con el transcurso de las generaciones. Es así como se puede establecer un continuo evolutivo en las especies vivas (evolución filogenética), de manera que unas proceden de otras, y podemos establecer estas relaciones por diversos métodos.

Es importante hacer notar que para que las especies evolucionen, tiene que haber variabilidad entre sus individuos. El enorme potencial evolutivo que da la reproducción sexual se debe a que ésta es capaz de generar una gran variabilidad dentro de una especie. Nótese que en la reproducción sexual no hay un individuo cuyo conjunto de caracteres genéticos (lo que llamamos en conjunto el genotipo) sea idéntico al de otro (excepto en el caso de gemelos univitelinos). De ahí que la aparición de la reproducción sexual con los eucariotes haya causado una radiación evolutiva de los seres vivos mucho más intensa y rápida que en los 2500 millones de años anteriores, en los que sólo existían los procariotes.

La teoría de la Selección Natural fue propuesta por Charles Darwin el siglo pasado como mecanismo para explicar la evolución de las especies vivientes. Recibió este nombre por contraposición a la Selección Artificial, que es la que realiza el agricultor o el ganadero al permitir únicamente los cruces de aquellos individuos con características más deseables desde el punto de vista económico.

(c) Genotipo y Fenotipo

Llamamos fenotipo al conjunto de caracteres morfológicos, funcionales, bioquímicos, conductuales, etc., que presenta un ser vivo. Gran parte del fenotipo es hereditario, esto es, corresponde a las características que un ser vivo recibe de sus progenitores; pero no todo el fenotipo lo es. Por ejemplo, una persona que ha aprendido a tocar el piano puede llegar a hacerlo muy bien a través del ejercicio y del aprendizaje. Saber tocar el piano es sin duda una característica fenotípica; sin embargo, ésta característica fenotípica no se hereda. Por, el contrario, el grupo sanguíneo, que también es una característica fenotípica, está determinado por los grupos sanguíneos de los progenitores.

El genotipo es el conjunto de genes que presenta un individuo. Muy frecuentemente estos genes determinan características que aparecen en el fenotipo; otras veces los genes no llegan a manifestarse. Así, una persona que tenga el grupo sanguíneo A puede tener un genotipo A0, es decir, un gen parental determina la presencia del carácter A y el otro gen parental 0; pero en este caso la presencia de A (carácter dominante) se impone a la característica 0 (carácter recesivo); el individuo es fenotípicamente A aunque también tenga el gen correspondiente al grupo 0.

El genotipo es un conjunto de información, es decir, una serie de instrucciones concretas mediante las cuales el ser vivo construye su fenotipo. Hoy sabemos que esta información tiene una estructura análoga al lenguaje (hablado o escrito) pero con cuatro letras (A,T,G y C) en lugar de las 26 del alfabeto latino. Esta información está constituída por una macromolécula lineal, el ácido desoxirribonucleico (ADN, DNA), que es un polímero constituído por la unión de monómeros de cuatro tipos distintos (los mencionados como A,T, G y C), de manera que una "frase" escrita en "lenguaje DNA" sería algo como esto:

ATTCGGCTTACGTTGAACTGTCCATCGAGGTAACTTCCTTTTACCG

(d) El Dogma Central de la Biología

Con el nombre de Dogma Central conocemos el flujo de información que tiene lugar en los seres vivos desde el genotipo para (a) formar el fenotipo y (b) para transmitirse a la siguiente generación.

En último término, los caracteres fenotípicos vienen determinados por la existencia de proteínas. Por ejemplo, la capacidad de tener la piel pigmentada depende de una reacción química en la que se forma el pigmento melanina. Para que esta reacción tenga lugar se necesita una enzima específica. Las enzimas son proteínas. Si en un individuo falta esta enzima la melanina no se forma, dando lugar al defecto hereditario que conocemos como albinismo. En último término, todas las características y funciones de un ser vivo tienen lugar gracias a que para cada función hay una proteína específica.

Las proteínas, al igual que los ácidos nucleicos, son polímeros lineales portadores de información. Pero a diferencia de aquéllos, cuyo lenguaje está constituído por cuatro "letras", el lenguaje de las proteínas está constituído por 20 aminoácidos, que son sus elementos monoméricos. Existe asimismo un código de una letra para desginar a los aminoácidos (pero aquí utilizamos 20 letras en vez de 4, todas excepto B, J, O, U, X y Z). Así, una "frase" en "lenguaje proteína" podría ser la siguiente:

MQWETRRLNMLALKSDHGFFCMVWDCIVCLIHDDKFGCTAPA

En la que cada letra representa un aminoácido. El orden en que aparecen los aminoácidos determina la estructura tridimensional que adopta todo el conjunto, y esto es lo determinante de la función de la proteína, como veremos después.

Pues bien, la información que contiene el DNA es la necesaria para determinar la estructura correcta de todas y cada una de las proteínas del organismo. Por ello, el DNA dirige la síntesis de proteínas indicando qué aminoácidos deben entrar, y en qué orden, para la formación de las mismas. En este proceso participa otro ácido nucleico, el ácido ribonucleico (ARN, RNA), de tal manera que:

1. La información contenida en el DNA se transmite a una molécula de RNA (proceso llamado transcripción) que recibe el nombre de "RNA mensajero" o mRNA.

2. La información contenida en el mRNA es "leída" por unas partículas subcelulares llamadas ribosomas, traduciendo el lenguaje nucleico al lenguaje proteína. La relación que hay entre ambos lenguajes recibe el nombre de Código Genético. Así, la palabra GTG en ácidos nucleicos en proteína se traduce por V; TTT por F, y así sucesivamente. Este proceso se denomina traducción.

El flujo de información para la expresión de los genes, es por lo tanto

DNA --> RNA --> Proteína

Pero la otra función del DNA es la de transmitirse a su descendencia. Esto lo hace el DNA duplicándose a sí mismo en el proceso conocido como replicación. Ahora bien: en la reproducción sexual, el nuevo individuo recibe la mitad de su DNA de cada uno de sus padres. Así, este individuo es genéticamente distinto de ambos: así es como la reproducción sexual genera variabilidad. Si el DNA se transmitiera a la célula o al individuo hijo sin variación ni mezcla de otros DNAs, como copia exacta del DNA parental, estaríamos ante la reproducción clónica.

(d) El modelo de interacción estereoquímica

Hasta ahora hemos visto que los ácidos nucleicos son una información que se traduce en las secuencias de unos determinados compuestos, las proteínas, y que éstas, en último término, son las responsables del fenotipo. Es decir, los ácidos nucleicos son los planos a partir de los que se construyen las máquinas de los seres vivos, que son las proteínas. ¿Cómo pueden las proteínas llevar a cabo las funciones propias de los seres vivientes?

Se ha llegado a la conclusión de que todas las funciones dependen de la interacción proteína - ligando, es decir, que la base molecular de todos los fenómenos biológicos es la unión de una molécula, o ligando, con una proteína. Esta unión es específica, lo que significa que el ligando sólo puede unirse a esa proteína y viceversa. Una vez unidos proteína y ligando, cambia la estructura del complejo respecto a las estructuras originales, por separado, de ambos componentes, y se produce un determinado efecto.

Por ejemplo: un complejo enzima-substrato (proteína-ligando) produce la transformación química de éste; un complejo receptor-neurotransmisor (proteína-ligando) determina la activación o inhibición de un neurona; un complejo receptor-hormona (proteína-ligando) determina las acciones fisiológicas propias de la hormona, y así sucesivamente.

La unión es específica porque las estructuras de la proteína y del ligando son estereoquímicamente complementarias; es decir, se ajusta una a la otra de la misma manera que una llave se ajusta a su cerradura, y sólo a ella. Dicho más coloquialmente, la proteína presenta una superficie a la que sólo puede fijarse su ligando específico.

Llamamos metabolismo al conjunto de reacciones químicas que tienen lugar en un ser vivo. Cada una de estas reacciones tiene su enzima específica que la cataliza. Siendo varios millares las reacciones metabólicas, existen por lo tanto varios millares de enzimas, cada una encargada de la catálisis de una particular reacción. Podemos entender entonces cómo un organismo viviente es un compendio de procesos químicos de transformación que tienen lugar en unas condiciones termodinámicas muy "suaves", que son la temperatura ambiente y la presión atmosférica. Por el contrario, los procesos químicos industriales convencionales suelen llevarse a cabo en condiciones mucho más drásticas (altas temperaturas y presiones) que consumen gran cantidad de energía. Por esta razón la Biotecnología puede ayudar a conseguir procesos industriales mucho más eficientes y energéticamente baratos, mediante el uso de las correspondientes enzimas. Si a esto añadimos la extraordinaria capacidad adaptativa de los microorganismos, se puede llegar a resultados sorprendentes. Por ejemplo, "enseñar" a una bacteria a destruir el crudo de petróleo de modo que éste se convierte en materia comestible.

VI. Compendio de aplicaciones biotecnológicas

Bancos de secuencias de DNA y proteínas

Entendemos por secuencia de un polímero el orden en que aparecen en la molécula sus monómeros. Dado que DNA, RNA y proteínas son polímeros que contienen información, sus monómeros ("letras") no aparecen ni al azar ni en estructuras repetitivas; por lo tanto, sus secuencias son únicas y hay que determinarlas.

Hoy día los procedimientos de secuenciación (descifrado de la secuencia) de DNA están al alcance de cualquier laboratorio mínimamente dotado. Es tal la cantidad de secuencias que se descifran en los laboratorios, que esta información se está reuniendo en bancos accesibles por Internet. Como la secuencia de las proteínas se obtiene a partir de las secuencias de DNA aplicando el Código Genético, existen asimismo bancos amplísimos de datos sobre secuencias de proteínas.

Toda esta información constituye una herramienta fundamental hoy día en la investigación bioquímica. Cualquier secuencia que obtenemos en el laboratorio puede ser inmediatamente contrastada (on line) con secuencias previamente descritas, ver sus similitudes, sus relaciones filogenéticas (evolutivas), etc.

Algunas direcciones de interés son:

Secuenciación de genomas completos

Las técnicas de secuenciación de DNA se aplican ya con todo éxito a la secuenciación del DNA de organismos completos, a pesar del enorme tamaño de las moléculas de DNA. Así, el genoma de una bacteria puede contener varios millones de nucleótidos; y en genoma humano, miles de millones.

Hasta ahora conocemos las secuencias completas de muchos virus, de algunas bacterias, y está muy avanzado el de un eucariote (la levadura Saccharomyces cerevisiae). Asimismo está en proyecto la secuenciación completa del genoma humano; esto tendrá, sin duda, consecuencias importantísimas de todo orden. En el presente curso hay una lección específicamente dedicada al Proyecto Genoma Humano.

Una aplicación interesantísima de los estudios de secuenciación son los estudios filogenéticos y evolutivos, para tratar de conocer las relaciones entre razas, tipos, variedades y especies. Un estudio particularmente notable ha sido el realizado sobre el DNA mitocondrial en poblaciones humanas actuales. Por su interés lo describiremos brevemente:

Las mitocondrias son organelas celulares que aparecen en los eucariotes, y su función es la de ser las "centrales energéticas" de la célula. El origen evolutivo de las mitocondrias es muy curioso: se trata, en realidad, de procariotes que en un momento dado se adaptaron a vivir simbióticamente con la célula eucariótica. Por esa razón, las mitocondrias tienen todas las características de las células procarióticas, y en particular, tienen su DNA propio, distinto del DNA nuclear que es propio de la célula.

Como es lógico, en el momento de la fecundación, todas las mitocondrias que recibe el nuevo individuo proceden de su madre, pero no de su padre; porque el espermatozoide no aporta nada más que su DNA. De esta manera, a través del DNA mitocondrial se puede seguir el origen evolutivo de todas las poblaciones humanas de una forma mucho más sencilla que examinando el DNA nuclear. Se han realizado estudios extensísimos sobre las secuencias de DNA mitocondrial de todas las poblaciones humanas actuales. Aplicando programas sofisticados de ordenador, se ha conseguido hacer un árbol evolutivo de toda la especie humana actual, con un sorprendente resultado: Todos los seres humanos que actualmente habitan el planeta, proceden de una sola mujer que vivió en Africa hace aproximadamente ciento treinta mil años.

Aplicaciones forenses

Las aplicaciones de la tecnología del DNA a cuestiones médico-legales forma ya parte del conocimiento generalizado a los medios de comunicación (pruebas de paternidad, por ejemplo). En esencia, consisten en que el DNA de cada persona es único y perfectamente identificable mediante técnicas cuya descripción quedaría fuera de este contexto.

De esta manera, hoy día se puede probar positivamente la paternidad de un individuo; a partir de la sangre y otros fluidos, determinar la identidad de las personas; se han llegado a identificar los cadáveres de la familia imperial rusa asesinada en 1917 por comparación con el DNA de sus descendientes y parientes actuales; asimismo, se han clonado con éxito muestras del DNA del faraón Ramsés II a partir de su momia.

Otras aplicaciones

- Sondas DNA con aplicaciones diagnósticas

- Terapia génica

- Fármacos producidos por ingeniería genética

- Nuevos tipos de alimentos

- Control medioambiental

- Plantas resistentes a plagas y enfermedades

- Plantas aclimatadas a nuevos hábitats

- Mejora ganadera

- Fármacos por cultivos vegetales

- Reproducción monocelular en vegetales

- Nuevos recursos biotecnológicos: extremófilos

Procesos industriales enzimáticos

Ya vimos anteriormente lo que son las enzimas: catalizadores específicos de reacciones metabólicas. Muchas de estas reacciones pueden llegar a tener interés industrial, y de hecho el uso industrial de enzimas se remonta ya a unos cuarenta años. Las enzimas (que son proteínas) presentan unas características altamente deseables en los procesos de la industria química, particularmente la ya mencionada especificidad y sobre todo, sus condiciones de trabajo, que al cursar a temperatura ambiente y presión atmosférica no dan lugar a grandes dispendios energéticos.

Ahora bien, el problema de las enzimas es su inestabilidad, siendo particularmente sensibles a la temperatura; de manera que la vida media puede llegar a ser muy corta. Otro inconveniente es su solubilidad en agua, lo cual hace difícil la recuperación de la enzima a partir de los medios de reacción. Mediante distintas técnicas estos problemas se han resuelto para algunas enzimas. Veamos ahora un resumen de sus principales aplicaciones industriales:

1. Industrias derivadas del almidón. En Estados Unidos, Canadá y Brasil, el almidón de origen vegetal (fundamentalmente maíz) se utiliza ampliamente con dos fines concretos: (a) la producción de alcohol combustible de uso en vehículos automóviles; (b) la producción de jarabes de fructosa, que se emplean como edulcorantes en la industria alimenticia (no así en la Unión Europea, que protege fuertemente los intereses del sector azucarero local); y la industria de panadería. En todos estos casos el papel de las enzimas es fundamental, sobre todo de enzimas derivadas de bacterias y hongos.

2. Industria de los detergentes. Desde 1959 se añaden enzimas proteolíticas (enzimas capaces de degradar proteínas) a los detergentes utilizados en el lavado doméstico, ya que con ello se facilita en gran medida la eliminación de manchas orgánicas. En la actualidad, las enzimas utilizadas con este propósito representan un 80 % del mercado mundial de enzimas. Las más empleadas son de origen bacteriano.

3. Industrias lácteas. En la preparación del queso, la leche se trata con cuajo, que es el contenido del estómago de terneras lactantes. El cuajo contiene una enzima, la quimosina, que es fundamental en la manufactura del queso. Ahora bien, dada su procedencia, el cuajo es poco abundante y muy caro. No valen, por otra parte, otras enzimas parecidas, puesto que el queso pierde gran parte de sus características deseables. Últimamente se ha comenzado a producir quimosina por ingeniería genética en bacterias, lo cual sin duda abaratará por órdenes de magnitud los precios actuales del cuajo.

Las industrias lácteas emplean muchas enzimas industriales en multitud de procesos: el aprovechamiento del suero lácteo y la eliminación enzimática de la lactosa. La lactosa es el azucar propio de la leche. Aparte de ser muy poco dulce, la lactosa presenta varios inconvenientes. En muchas poblaciones del Tercer Mundo es generalizada la intolerancia a la lactosa, defecto genético que impide una alimentación normal a base de leche en los lactantes. Otro inconveniente planteado por la lactosa es su relativamente pobre solubilidad en agua, lo que hace que precipite en forma de cristales al fabricar helados y otros productos alimenticios. Para ello, la industria láctea trata la leche con enzimas que hidrolizan la lactosa a sus azúcares componentes, glucosa y galactosa, con lo cual se pueden obviar los inconvenientes citados.

4. Industrias de la fruta. Las industrias de zumos de fruta utilizan ampliamente enzimas para incrementar el rendimiento y la clarificación de jugos. Como en los casos anteriores, siempre se trata de enzimas bacterianas y fúngicas.

5. Otras industrias: las enzimas se utilizan ampliamente en la industria de los antibióticos (preparación de penicilinas semisintéticas), de los aminoácidos, etc.

El problema de la inestabilidad de las enzimas se atenúa mediante dos procedimientos: (a) la inmovilización de las mismas, que las protege al tiempo que permite su recuperación; (b) el empleo de enzimas procedentes de organismos extremófilos (particularmente termoacidófilos). En torno a la búsqueda de enzimas industriales hay una gran cantidad de investigación clasificada que utiliza ampliamente la ingeniería genética. Japón es, en la actualidad, el país más avanzado en tecnología enzimática.

Por otra parte, se está investigando mucho en el terreno de las enzimas artificiales, compuestos de mayor estabilidad que las proteínas pero que producen los mismos mecanismos catalíticos.

Biosensores

Las enzimas no solamente tienen aplicaciones industriales; son hoy día elementos importantísimos en las técnicas analíticas. Hasta tal punto, que la mayor parte de reactivos que se emplean en los laboratorios clínicos están basados en enzimas. Un desarrollo particularmente importante es el de reactivos en fase sólida (tiras reactivas) que está poco a poco revolucionando los sistemas de análisis clínico, después del éxito de las tiras reactivas para diabéticos.

Pero en este terreno el desarrollo más importante sin duda es el de los biosensores. Se trata de elementos, generalmente miniaturizados, que incorporan enzimas para reconocer compuestos específicos, de tal manera que la interacción produce una corriente eléctrica. Así, si utilizamos una enzima que reconoce a la glucosa, podemos desarrollar un sistema capaz de medir en tiempo real la concentración de glucosa en sangre. Se abre así la posibilidad de sensores miniaturizados que pueden ser introducidos en un organismo y que pueden estar conectados a microbombas de inyección de medicamentos. Así se ha desarrollado un páncreas artificial que libera insulina en función de la glucosa presente en la sangre, y que sería una magnífica solución para el tratamiento de la diabetes.

Hoy día existen biosensores basados en enzimas para muchísimas aplicaciones, tanto clínicas como industriales.

Biochips

Lo último en tecnología enzimática es la incorporación de enzimas a elementos de microelectrónica, lo cual abre unas posibilidades increíbles en todos los campos, y particularmente en la medicina (visión y audición artificial, etc.). Hay propuestas serias de la introducción de proteínas como elementos básicos de ordenadores electrónicos. En este curso trataremos en concreto de este desarrollo.

VII. Cuestiones socioculturales y éticas planteadas por la Biotecnología

El interés del público en las cuestiones biotecnológicas va en franco aumento. Sin pretensiones de ser exhaustivo, pasaremos revista a los principales factores determinantes de este interés y de esta preocupación.

Los medios de comunicación

No exageramos un ápice al afirmar, como ya se ha hecho en esta lección, que las películas de Spielberg "Parque Jurásico" y, en menor medida "El Mundo Perdido" han contribuído en gran medida a este interés. La posibilidad, bastante fantástica (pero sin duda real) de resucitar dinosaurios a partir de sus genomas, con las catastróficas consecuencias medioambientales que ello implica, han suscitado debates a muchos niveles, llevados a cabo sobre todo en los Estados Unidos.

Igualmente, el papel de los medios de comunicación ha sido determinante en la difusión generalizada de los experimentos de clonación, resucitando viejas ficciones científicas como "Un Mundo Feliz" de Aldous Huxley.

Salida al mercado de organismos transgénicos

Se han empezado a comercializar organismos transgénicos (en particular vegetales, como el tomate y la soja) y determinadas organizaciones ecologistas como Greenpeace han tomado una postura militante en contra.

El ciudadano y el científico

Existe sin duda una progresiva disociación del ciudadano respecto al estamento científico (que se remonta al proyecto Manhattan). La figura del científico loco del XIX se ha visto sustituída por una visión más estremecedora: la de equipos anónimos de muy alta tecnología trabajando en lugares ultrasecretos a favor de intereses inconfesables. Así nos encontramos con una preocupación creciente por la biotecnología en general. La posibilidad de guerra biológica basada en la biotecnología es demasiado real (y desgraciadamente barata) como para pasarla por alto.

La epidemia de SIDA

Cuando la confianza y la autocomplacencia de la especie humana en las posibilidades terapéuticas desarrolladas a lo largo del siglo XX (en particular los antibióticos) estaban en su apogeo, surgió en los primeros años ochenta una epidemia, cuyas consecuencias todos conocemos, de Síndrome de Inmunodeficiencia Adquirida (SIDA) que sacudió hasta sus cimientos dicha confianza. Es cierto que todo el arsenal investigador bioógico actual se puso al servicio de encontrar vacunas y tratamientos adecuados; pero tras casi veinte años de investigación exhaustiva, estamos actualmente sin vacuna y sólo con un tratamiento terriblemente caro cuya eficacia no está del todo comprobada. Al mismo tiempo, el SIDA sigue creciendo en el Tercer Mundo, donde las proporciones de infectados son francamente pavorosas (10-20 % de la población). Este factor ha contribuído sin duda a incrementar la disociación entre el ciudadano y el científico que antes apuntábamos. No es de extrañar que haya habido rumores sobre un posible origen artificial del virus del SIDA, "escapado" de un laboratorio de guerra biológica.

La preocupación medioambiental

Asimismo, la preocupación por el medio ambiente ha dejado de ser cuestión reservada a los ecologistas y ha pasado al dominio público, que ve claramente cómo éste se degrada ante sus propios ojos. Por eso existe una desconfianza reactiva ante todo desarrollo tecnológico; no se escapa de esta tendencia la biotecnología, con la posibilidad que brinda de crear organismos "nuevos" y por tanto impredecibles. Al tiempo, desde los laboratorios de investigación biológica se nos advierte de la enorme (insondable) complejidad de la maquinaria viviente, en la que son moneda común y corriente los procesos no-lineales, de comportamiento caótico y por lo tanto, fuera de nuestro control.

Los fundamentalismos

Si entendemos por fundamentalismo la aceptación de sistemas no-racionales como actitud determinante ante la vida, no hay duda de que los fundamentalismos están, en este fin de siglo, a la orden del día. En nuestro contexto, los fundamentalismos son preocupantes sobre todo en el terreno de la biología reproductiva humana, donde existen tabúes de índole religiosa que nos ocultan los verdaderos problemas éticos que, desde una postura ilustrada, podemos señalar en la biotecnología. Hay sin duda una tendencia preocupante hacia el irracionalismo, en muchos casos alentada desde los propios medios de comunicación.

Nuevos problemas no previstos

Las posibilidades diagnósticas de la ingeniería genética son enormes. Muchas enfermedades, o propensiones a las mismas pueden ser diagnosticadas por tecnología genética antes de que se declare efectivamente la enfermedad. Ante una cuestión como ésta, surgen problemas nuevos.

Por ejemplo, la actitud de las compañías de seguros. Si en el momento actual suscribir una póliza de seguro implica un examen médico, bien podemos pensar que en el futuro se pueda exigir un examen genético, y que de ese examen salga un resultado que sea demasiado arriesgado para dichas compañías, cuya función es simplemente ganar dinero. Esto puede llevar a discriminaciones hasta ahora impensables, que pueden ser extensivas a la búsqueda de un empleo, donde la empresa puede exigir también ese examen genético. De la "limpieza de sangre" en el XVI español podemos pasar a una "limpieza de DNA" mucho más espeluznante, por cuanto que deriva de la ciencia positiva, y no de creencias subjetivas.

Ante este panorama, que fue previsto por los científicos a mediados de la década de los setenta, las reacciones han sido variadas y descoordinadas. Bien es verdad que por primera vez en la historia, sin ningún precedente, se reunió una conferencia en Asilomar (EEUU) en 1975 para dictar reglas aplicables a los experimentos de transferencia genética, como así se hizo efectivamente. Un concepto clave en estas reglas era el de "contención". Tómese esto en un doble sentido: (a) en primer lugar, todos los experimentos de transferencia deberían llevarse a cabo en organismos incapaces de vivir fuera del laboratorio. Esto se logró mediante el uso de la cepa K-12 de la bacteria Escherichia coli, el auténtico caballo de batalla de la ingeniería genética. (b) Quedaba terminantemente prohibida la liberación al exterior de organismos modificados genéticamente.

Ahora bien, las prescripciones de Asilomar se revelaron pronto como un intento de poner puertas al campo. La investigación biotecnológica resultó ser enormemente atractiva, entre otras cosas, por su costo: es relativamente barata, y al alcance de cualquier laboratorio. En nuestra Universidad, por ejemplo, podemos estimar que hay unos veinte grupos de investigación que operan con tecnología genética de manera rutinaria. Al mismo tiempo, su espectacularidad garantizó un crecimiento exponencial, que todavía se mantiene. Las reglas de Asilomar prescribían la prohibición de liberar al medio ambiente organismos genéticamente modificados. Hoy encontramos esos organismos incluso en el supermercado. Si se ha clonado con éxito una oveja, no hay duda de que alguien lo intentará con organismos humanos.

En Estados Unidos, que es el país que ha llevado a cabo más a fondo la revolución biotecnológica (con la posible excepción de Japón), ha habido múltiples intentos de reglamentar la biotecnología en general, con resultados escasos. En la actualidad, por ejemplo, existe la prohibición de financiar con fondos federales experimentos de clonación humana; pero el público, con toda razón, piensa que eso no es suficiente. En un país donde la financiación privada de la investigación es la norma, una prohibición federal se queda en nada. Existe asimismo un enorme solapamiento entre normativas dictadas por agencias federales (National Institutes of Health, U.S.Department of Defence, U.S.Department of Agriculture, Food and Drug Administration, U.S.Department of Commerce, etc.) que complica aún más el panorama. A esto añádase la tradicional hostilidad del americano medio hacia el intervencionismo estatal.

Ante todo ello, no cabe más remedio que confiar en las instituciones democráticas de nuestros países. En ese sentido, personalmente prefiero la actitud europea que dio origen al Estado del Bienestar y que ha sido capaz de crear instituciones públicas de seguridad social, que sin duda valorarán los riesgos genéticos, pero dentro de un contexto estadístico que impida las discriminaciones de las que antes hablábamos, por ejemplo. Y para ello, nada mejor que la información seria y contrastada, llevando al ánimo de los medios de comunicación social no sólo los inconvenientes, sino también las ventajas de la biotecnología, de manera que podamos contar con una opinión pública informada. En Dinamarca, por ejemplo, está tomando carta de naturaleza la discusión por paneles de ciudadanos de todos estos problemas. Así, habiendo sido confrontados con las posibilidades de organismos transgénicos, el panel correspondiente llegó a la sabia conclusión de que es inaceptable utilizar la transgénesis para crear nuevos y exóticos animales de compañía, pero sin embargo totalmente recomendable utilizarla para mejorar la salud (humana y animal).

De todas las consideraciones anteriores podemos deducir la utilidad del presente curso. Creo que los medios de comunicación, en una sociedad democrática, deben ser la "interfaz" adecuada para acercar a la sociedad civil a sus investigadores, y viceversa. Uno de los problemas más preocupantes en este contexto que hemos discutido es el progresivo apartamiento que, debido ante todo a un lenguaje científico cada vez más esotérico, se está apreciando entre los colectivos citados. Todo esfuerzo por invertir esta tendencia bien hecho estará.

GLOSARIO

Ácido desoxirribonucleico (DNA, ADN): molécula polimérica compuesta de nucleótidos, que constituye el material genético. La información que contiene se expresa por la secuencia de nucleótidos. Estos pueden ser de cuatro tipos: Adenina (A), Timina (T), Guanina (G) y Citosina (C)

Ácido ribonucleico (RNA, ARN):m olécula polimérica compuesta de nucleótidos. El RNA es un intermediario en la transferencia del mensaje genético entre el DNA y las proteínas. Es el material genético de alguno organismos; por ejemplo, del virus VIH, causante del SIDA.

Acidos nucleicos: polímeros formados por la aposición lineal de nucleótidos. Pueden ser de dos tipos: ácido desoxirribonucleico (DNA, ADN) y ácido ribonucleico (RNA, ARN).

ADN: Véase Ácido desoxirribonucleico

Albinismo: Defecto genético recesivo consistente en la incapacidad de sintetizar melanina. Los individuos afectados poseen una piel anormalmente blanca, pelo rubio y carecen de pigmento en todas sus células, en particular en el iris y en la retina.

Almidón: polímero compuesto por moléculas de glucosa, que constituye la reserva energética de las células vegetales y como tal es un contingente muy importante de la dieta humana. Abunda en la patata y en los granos de cereales.

Aminoácido: moléculas que son los monómeros de las proteínas, llamados así por tener un grupo amino (básico) y un grupo carboxilo (ácido). En las proteínas entran 20 aminoácidos distintos.

Antibiótico: Producto del metabolismo secundario de algunos microorganismos mediante el que combaten a otros posibles competidores. Se utilizan ampliamente en Medicina

Anticuerpo: proteína producida por células inmunológicamente competentes, suscitadas por la presencia de organismos o moléculas extrañas, capaces de fijarse a los mismos y neutralizar su acción.

Anticuerpo monoclonal: anticuerpo producido por un solo clon celular, es decir, un grupo de células idénticas que proceden de una única célula progenitora. Su uso está generalizado en procedimientos diagnósticos y de investigación.

ARN: Véase Ácido ribonucleico

Arquebacteria: Uno de los tres grandes tipos celulares. Las Arquebacterias son procariotes muy diferenciados químicamente de las bacterias propiamente dichas. Algunos de sus procesos tienen más parecido con los eucariotes. Muchas arquebacterias son extremófilas, es decir, habituadas a ambientes extremos de temperatura, presión, pH, etc. De ahí su interés biotecnológico.

Bacterias: Procariotes que presentan una serie de características metabólicas y moleculares que las distinguen de las Arquebacterias, el otro gran grupo de procariotes. Son Bacterias la mayoría de los procariotes conocidos, y están adaptados a una enorme diversidad de medios y hábitats. Las bacterias son los organismos mejor estudiados desde el punto de vista molecular y biotecnológico. Algunas son patógenas (productoras de enfermedades).

Bacterias fijadoras de nitrógeno: bacterias del suelo, capaces de convertir el nitrógeno atmosférico en compuestos amínicos como las proteínas. Algunas de ellas viven en simbiosis con las Leguminosas.

Biochip: Dispositivo microelectrónico con funciones biológicas (ayudas acústicas o visuales, por ejemplo) o bien que incorpora proteínas con funciones de reconocimiento específico de ligandos.

Biomasa: Conjunto de organismos vivos que se multiplican sobre residuos agrícolas o ganaderos mientras producen energía en forma de gas metano.

Biosensor: Dispositivo analítico miniaturizado que reconoce una determinada molécula gracias a una proteína, generalmente enzimática, incorporada a su estructura.

Calcitonina: Hormona producida en la glándula tiroides, responsable del depósito de calcio en los huesos. Se utiliza para combatir la osteoporosis.

Carácter dominante: cada organismo formado por reproducción sexual recibe dos copias de un mismo gen: una del padre y otra de la madre. Se llama carácter dominante aquel cuya expresión oculta la del otro. Por ejemplo, dado un genotipo A0 en los grupos sanguíneos, el fenotipo es A, porque A es dominante sobre 0.

Carácter recesivo: el gen cuya expresión queda oculta por la de su pareja (o alelo), y que sólo puede expresarse cuando los dos alelos son iguales. Por ejemplo, un individuo con el grupo sanguíneo 0 tiene que tener un genotipo 00, dado que éste es recesivo.

Catalizador: Agente capaz de acelerar una reacción química sin sufrir ninguna modificación en la misma.

Célula: Unidad fundamental, autónoma, de los seres vivos. Su individualidad se mantiene gracias a una membrana que separa su contenido del exterior. En el interior ce la célula hay una fase líquida, llamada citoplasma. En las células eucarióticas hay asimismo un núcleo celular, donde radica el material genético (DNA) y una serie de partículas subcelulares llamadas organelas.

Células germinales: Células que han sufrido un proceso de reducción cromosómica (meiosis) de manera que quedan con la mitad del genoma de un individuo. Son el óvulo (o gameto femenino) y el espermatozoide (o gameto masculino)

Células inmovilizadas: Células vivas que por manipulaciones artificiales han quedado fijadas sobre una matriz, al objeto de desarrollar alguna reacción química con aplicaciones industriales o biotecnológicas.

Citoplasma: Fase líquida de la célula, rodeada por la membrana celular.

Clonación: Proceso de producción de un clon. Se llama clon un conjunto de células, todas idénticas entre sí, que proceden de una única célula progenitora. Por extensión, hablamos de clonación del DNA cuando producimos múltiples copias idénticas de un DNA determinado, o de clonación de individuos cuando por técnicas de reproducción asistida se genera un individuo genéticamente igual a otro.

Código Genético: Relación entre la secuencia de nucleótidos del DNA y la secuencia de aminoácidos de la proteína que codifica. Esta relación es tal que tres nucleótidos (un triplete o codon) determinan un aminoácido. Así, la secuencia TTT codifica por al aminoácido fenilalanina (F), GTG por valina (V), etc.

Cromosoma: Estructura molecular compuesta de DNA y proteínas, que se hacen aparentes en el momento de la división celular en eucariotes. El número de cromosomas es característico de la especie. Así, la especie humana presenta 46 cromosomas.

Enfermedad de Kreutfeld-Jacob: enfermedad cerebral degenerativa contagiada a partir de la ingestió de tejido nervioso enfermo. Tiene gran parecido con la llamada "enfermedad de las vacas locas".

Enzima: Catalizador biológico de naturaleza proteínica. Actúa sobre una sola reacción metabólica y es altamente específica hacia el compuesto que ataca, que recibe el nombre de substrato.

Estereoquímica: expresión que alude a la forma tridimensional, en el espacio, de una molécula.

Eucariote: Tipo celular caracterizado por la presencia de núcleo, organelas, gran tamaño, lentitud reproductiva y posibilidad de diferenciación (especialización). Es el tipo celular propio de organismos pluricelulares (hongos, plantas y animales), de los hongos unicelulares (levaduras) y de los Protistas (protozoos)

Exponencial, crecimiento: fase del crecimiento en la que el ritmo de multiplicación es directamente proporcional a la masa instantánea. Durante el crecimiento exponencial el tiempo de duplicación es constante.

Fecundación in vitro: proceso mediante el cual se ponen en contacto gametos femeninos (óvulos) y masculinos (espermatozoides) en un tubo de ensayo al objeto de lograr una fecundación fuera de su ámbito natural.

Fenotipo: conjunto de caracteres morfológicos, funcionales, bioquímicos y conductuales que presenta un organismo, y que definen su individualidad.

Fermentación: transformación química de un compuesto llevada a cabo por el crecimiento en medio líquido de un microorganismo. Así, en la fermentación alcohólica la levadura (un hongo unicelular) convierte la glucosa en alcohol etílico al tiempo que se multiplica.

Filogenia: el continuo evolutivo de las especies vivientes

Fructosa: azúcar de sabor intensamente dulce, presente en muchas frutas y uno de los componentes del azúcar común o sacarosa.

Gemelos univitelinos: dos organismos genéticamente idénticos que proceden de un solo óvulo fecundado.

Gen: fragmento de DNA en el que se contiene el código necesario para la síntesis de una determinada proteína o RNA. El estudio de los genes constituye la ciencia que llamamos Genética.

Genoma: conjunto del material genético de un organismo.

Genotipo: conjunto de genes que presenta un organismo.

Grupo sanguíneo: características moleculares propias de la superficie de los hematíes o glóbulos rojos de la sangre. Hay muchos grupos sanguíneos descritos; los más conocidos son el sistema AB0, según el cual, las personas pueden pertenecer a los grupos 0, A, B y AB. Los grupos sanguíneos se heredan, siendo los caracteres A y B dominantes y el 0 recesivo.

Hipófisis: Glándula situada en la base del cerebro, responsable de la secreción de muchas hormonas, entre ellas la de crecimiento o STH.

Hormona: señal química producida por las glándulas endocrinas, responsable de una serie de respuestas fisiológicas.

Hormona de Crecimiento (STH, GH): hormona proteica producida por la hipófisis anterior, glándula situada en la base del cerebro. Controla y regula el crecimiento en la especie humana. Su falta determina la aparición de enanismos proporcionados; su exceso determina gigantismo o acromegalia.

Ingeniería Genética: Conjunto de técnicas químicas y biológicas que se utilizan en torno al DNA: aislamiento, purificación, secuenciación, multiplicación y transferencia del mismo.

Inmunología: Con el nombre de respuesta inmune conocemos un conjunto de acciones suscitadas en los organismos animales por la presencia de células o componentes extraños. La respuesta inmune tiene dos aspectos fundamentales: la inmunidad humoral, a través de la que el organismo produce anticuerpos, proteínas capaces de unirse a los componentes ajenos al organismo y neutralizar su acción; y la inmunidad celular, en la cual se activan células que destruyen los elementos extraños (por ejemplo, el rechazo de transplantes)

Insulina: Hormona peptídica producida por clas células B del islote de Langerhans del páncreas. Provoca la entrada masiva de glucosa en los tejidos muscular y adiposo, disminuyendo así el nivel de glucosa en sangre. Su falta determina la diabetes tipo I o juvenil

Lactosa: es el azúcar propio de la leche, compuesto por glucosa y galactosa.

Levadura: nombre que se da a ciertos hongos unicelulares, como Saccharomyces cerevisiae, muy utilizados en biotecnología.

Ligando: molécula que se fija de manra específica y estereoquímicamente complementaria a una proteína.

Lisosoma: organela presente en eucariotes, cuya función es la digestión de las partículas alimenticias ingeridas por la célula.

Metabolismo: conjunto de reacciones químicas que tienen lugar en un organismo vivo. Cada reacción está catalizada por una enzima específica.

Mitocondria: organela presente en eucariotes, encargada de la producción de energía a través de oxidaciones aeróbicas (que utilizan oxígeno).

Monómero: molécula unidad que se repite en un polímero.

Neurona: célula propia del sistema nervioso, caracterizada por poder excitarse y transmitir esta excitación a otra célula.

Neurotransmisor: molécula producida por una neurona en respuesta a su excitación, y que transmite una señal a otra célula, ya sea de excitación o de inhibición. La mayoría de las drogas de abuso se comportan de alguna manera como neurotransmisores.

Núcleo: parte de la célula eucariótica, separada del citoplasma por una membrana, que contiene el material genético estructurado en forma de cromosomas.

Nucleótido: monómero de los ácidos nucleicos. En el DNA son A, G, T y C; en el RNA, A, G, U y C.

Organela: partícula subcelular con funciones determinadas (producción de energía, digestión, secreción, etc.)

Peroxisoma: organela presente en eucariotes cuya función está ligada a la función antioxidante (es decir, la supresión de los efectos tóxicos del oxígeno).

Pluricelular (organismo): Organismo constituído por muchas células, que se organizan y estructuran según el principio de la división del trabajo mediante el fenómeno de la diferenciación. Todos los organismos pluricelulares son eucariotes.

Polímero: Molécula de gran tamaño, formada por la aposición sucesiva de otras moléculas pequeñas, llamadas monómeros.

Procariote: tipo celular que carece de núcleo, presentando su material genético libre en el citoplasma, sin formar un núcleo. Son de tamaño pequeño, gran velocidad reproductiva y gran adaptabilidad. Siempre son unicelulares. Distinguimos en ellos las bacterias y las arquebacterias.

Proteína: polímero lineal constituído por aminoácidos, cuya estructura tridimensional es capaz de fijar específicamente ligandos y desarrollar así sus funciones. Un conjunto muy importante de proteínas son las enzimas, catalizadores específicos de todas las reacciones metabólicas.

Proteolisis: proceso, generalmente enzimático, de degradación de las proteínas a sus aminoácdos constituyentes.

Quimosina: enzima presente en la secreción del estómago de terneras lactantes (cuajo), a partir de la cual se fabrica el queso.

Receptor: Molécula de proteína que reconoce específicamente una señal molecular.

Reproducción asistida: Conjunto de técnicas de manipulación de células germinales conducentes a solucionar problemas de esterilidad o infertilidad.

Reproducción clónica: forma de reproducción en la que se genera un individuo genéticamente idéntico a otro.

Reproducción sexual: forma de reproducción en la que el nuevo individuo recibe su genoma de otros dos individuos de la misma especie, de manera que cada uno contribuye con la mitad del nuevo genoma. Su característica fundamental es la enorme variabilidad que genera en las especies. Es propia de los eucariotes, aunque en algunos procariotes hay formas primitivas de la misma.

Ribosoma: Partícula subcelular sobre la cual se forman las proteínas en un proceso dirigido por el mRNA (RNA mensajero).

Secuencia: Orden en que aparecen los monómeros en un polímero.

Simbiosis: cooperación entre dos organismos distintos en la que ambos sacan provecho del otro.

Substrato: Molécula sobre la que actúa una enzima, transformándola.

Traducción: Proceso mediante el cual el RNA mensajero (mRNA) es leído por los ribosomas para formar proteínas.

Transcripción: Proceso mediante el cual se forma una molécula de mRNA (RNA mensajero) cuya secuencia reproduce la del DNA.

Transgénicos, organismos: Organismos a los que mediante manipulaciones artificiales se han introducido genes de otros seres vivientes.

Unicelular, organismo: Ser vivo que consta de una sola célula. Algunos son eucariotes (el reino Protistas, protozoos) y los demás son procariotes (Bacterias y Arquebacterias)

Virus: Agregado molecular que consta de un ácido nucleico rodeado de una cubierta proteica. El ácido nucleico, que puede ser RNA o DNA, sólo puede expresarse en el interior de una célula viva, eucariótica o procariótica, a la cual parasita el virus, reproduciendo su mensaje genético.

REFERENCIAS

Biotecnología de cultivos hortícolas

Lozano Ruiz, R.; Cuadrado Gómez, I.M.

Año: 2000 (1ª Ed.)

Idioma: Español--Págs: 186

Biotecnología e ingeniería

V.V.A.A.

Año: 1999 (1ª Ed.)

Idioma: Español--Págs: 149

Conservación y caracterización de recursos fitogenéticos

Fernando González-Andrés; José M. Pita Villamil (eds.)

Año: 2001 (1 Ed.)

Idioma: Español--Págs: 279

Introducción a la mejora genética vegetal

Cubero, J.I.

Año: 1999 (1ª Ed.)

Idioma: Español--Págs: 365

Marcadores genéticos en la mejora vegetal, Los

Nuez, F.; Carrillo, J.M.

Año: 2000 (1 Ed.)

Idioma: Español--Págs: 579

 

 

 

Bistec. Emilio Alfredo Lucas Carrillo

elucas42@hotmail.com

Articulos relacionados:
Biología
Resumen:
La célula. Organización subcelular. La división celular. Evolución Humana. Genética. Genética - Meiosis. ¿Que es una especie?. ¿Qué es la especiación?. ¿Como se originan ...
Esterilización y desinfección
Resumen:
Como control de enfermedades infecciosas por destrucción, disminución o inhibición de microorganismos. Agentes físicos. Agentes químicos. Desinfectantes y antisépticos. C...
Membrana Plasmática
Resumen:
Estructura de la membrana. Proteínas de la membrana. Composición lipídica. Funciones de la membrana plasmática. Transporte a traves de membrana. Endocitosis y exocitosis....
Virus
Resumen:
Características. Replicación. Los virus en la medicina. Propagación. Tratamiento. Infecciones en plantas. Papel en la investigación. Bacteriófago T4. Estructura viral. Re...
La combinación de la poda y bioplaguicidas de Azadirachta indica A. Juss, una alternativa para el control de Hypsipyla grandella Zeller en plantaciones en fomento de Cedrela odorata L.
Resumen:
Tiene como objetivo proponer un método de control de Hypsipyla grandella Zeller en plantaciones en fomento de Cedrela odorata L., a través de la combinación de la poda y ...
Copyright © 2011 ilustrados.com, Monografias, tesis, bibliografias, educacion. Tofos los temas y publicaciones son propiedad de sus respectivos autores ©